CDS

Accession Number TCMCG017C30457
gbkey CDS
Protein Id OMO62265.1
Location complement(join(9118..9209,9302..9374,9443..9504,10047..10102,10239..10330,10417..10506))
GeneID InterPro:IPR016046
Organism Corchorus olitorius
locus_tag COLO4_33156

Protein

Length 154aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA215141, BioSample:SAMN03160584
db_source AWUE01021418.1
Definition Transcription initiation Spt4-like protein [Corchorus olitorius]
Locus_tag COLO4_33156

EGGNOG-MAPPER Annotation

COG_category K
Description May regulate transcription elongation by RNA polymerase II. May enhance transcriptional pausing at sites proximal to the promoter, which may in turn facilitate the assembly of an elongation competent RNA polymerase II complex
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko03019        [VIEW IN KEGG]
ko03021        [VIEW IN KEGG]
KEGG_ko ko:K15171        [VIEW IN KEGG]
EC -
KEGG_Pathway -
GOs GO:0000993        [VIEW IN EMBL-EBI]
GO:0001098        [VIEW IN EMBL-EBI]
GO:0001099        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003676        [VIEW IN EMBL-EBI]
GO:0003700        [VIEW IN EMBL-EBI]
GO:0003723        [VIEW IN EMBL-EBI]
GO:0003727        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005515        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0005654        [VIEW IN EMBL-EBI]
GO:0006139        [VIEW IN EMBL-EBI]
GO:0006325        [VIEW IN EMBL-EBI]
GO:0006355        [VIEW IN EMBL-EBI]
GO:0006357        [VIEW IN EMBL-EBI]
GO:0006396        [VIEW IN EMBL-EBI]
GO:0006397        [VIEW IN EMBL-EBI]
GO:0006725        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0006996        [VIEW IN EMBL-EBI]
GO:0008023        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0009889        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0010467        [VIEW IN EMBL-EBI]
GO:0010468        [VIEW IN EMBL-EBI]
GO:0010556        [VIEW IN EMBL-EBI]
GO:0016043        [VIEW IN EMBL-EBI]
GO:0016070        [VIEW IN EMBL-EBI]
GO:0016071        [VIEW IN EMBL-EBI]
GO:0019219        [VIEW IN EMBL-EBI]
GO:0019222        [VIEW IN EMBL-EBI]
GO:0019899        [VIEW IN EMBL-EBI]
GO:0031323        [VIEW IN EMBL-EBI]
GO:0031326        [VIEW IN EMBL-EBI]
GO:0031974        [VIEW IN EMBL-EBI]
GO:0031981        [VIEW IN EMBL-EBI]
GO:0032044        [VIEW IN EMBL-EBI]
GO:0032784        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0034243        [VIEW IN EMBL-EBI]
GO:0034641        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043175        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043233        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044428        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044451        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0044877        [VIEW IN EMBL-EBI]
GO:0046483        [VIEW IN EMBL-EBI]
GO:0050789        [VIEW IN EMBL-EBI]
GO:0050794        [VIEW IN EMBL-EBI]
GO:0051171        [VIEW IN EMBL-EBI]
GO:0051252        [VIEW IN EMBL-EBI]
GO:0051276        [VIEW IN EMBL-EBI]
GO:0060255        [VIEW IN EMBL-EBI]
GO:0065007        [VIEW IN EMBL-EBI]
GO:0070013        [VIEW IN EMBL-EBI]
GO:0070063        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]
GO:0080090        [VIEW IN EMBL-EBI]
GO:0090304        [VIEW IN EMBL-EBI]
GO:0097159        [VIEW IN EMBL-EBI]
GO:0140110        [VIEW IN EMBL-EBI]
GO:1901360        [VIEW IN EMBL-EBI]
GO:1901363        [VIEW IN EMBL-EBI]
GO:1903506        [VIEW IN EMBL-EBI]
GO:2000112        [VIEW IN EMBL-EBI]
GO:2001141        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGGAAGCCAACCCGCACAGATTCCGACGAGCTTCGGACACGAGCTTAGGGCTTGCCTTCGTTGCCGTCTCGTCAAAACCTTTGATCAGTTTAGAGAATCTGGATGTGAAAACTGCCCATTCTTTAAATTGGAAGAAGAAAGCGACCGCGTCGCGGAATGCACTACTCCTAACTTCAACGGTATAATCTCTGTTATGGACCCTTCTAGAAGTTGGGCTGCTCGTTGGCTGCGAATTGGAAGATTTGTCCCTGGTTGCTACACTCTTGCAGTTTCAGAGGCACTTCCAGAGGACTTGCAGGGATATCTGCTTACCTTTTCCGGAGCAAATCTTAAGAGTGATTACAATGGAACACAATATGGGCATGTCGATTGGGCATTCTTAGATTTATTTAAAACCTTTGCTCGTCTCAATCTTATTGTTATTTTCAACATGATGGTTGTGGTGCTTCCATTGAGTAAATGA
Protein:  
MGSQPAQIPTSFGHELRACLRCRLVKTFDQFRESGCENCPFFKLEEESDRVAECTTPNFNGIISVMDPSRSWAARWLRIGRFVPGCYTLAVSEALPEDLQGYLLTFSGANLKSDYNGTQYGHVDWAFLDLFKTFARLNLIVIFNMMVVVLPLSK